{"product_id":"proteintech-60161-2-ig","title":"Proteintech, 60161-2-Ig, MSH2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MSH2 (60161-2-Ig) by Proteintech is a Monoclonal antibody targeting MSH2 in WB, IHC, ELISA applications with reactivity to human samples\n60161-2-Ig targets MSH2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-468 cells,  Saos-2 cells,  COLO 320 cells,  A431 cells,  HuT 78 cells,  MOLT-4 cells,  K-562 cells\nPositive IHC detected in: Ramos cells, human appendicitis tissue,  human rectal cancer tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMSH2, named for its homologous to the E.coli MutS gene, takes part in DNA mismatch repair(MMR) to maintain the stability of DNA. MSH2 contains a helix-turn-helix domain, which responds for binding to DNA. Also, MSH2 has a direct role in mutation avoidance and micro-satellite stability in cell.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7835 Product name: Recombinant human MSH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 585-934 aa of BC021566 Sequence: SSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT Predict reactive species\nFull Name: mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC021566\nGene Symbol: MSH2\nGene ID (NCBI): 4436\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P43246\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888295071913,"sku":"60161-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60161-2-ig","provider":"Iright","version":"1.0","type":"link"}