{"product_id":"proteintech-60186-1-ig","title":"Proteintech, 60186-1-Ig, Cyclin D1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cyclin D1 (60186-1-Ig) by Proteintech is a Monoclonal antibody targeting Cyclin D1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n60186-1-Ig targets Cyclin D1 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, A549 cells,  HeLa cells,  NIH\/3T3 cells,  RAW 264.7 cells,  A431 cells,  SW 1990 cells,  HepG2 cells,  U2OS cells,  HCT 116 cells,  SK-N-SH cells,  HSC-T6 cells,  PC-12 cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCND1 (cyclin D1), also known as PRAD1 or BCL1, belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. CCND1 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1\/S transition. The CCND1 gene, located on 11q13 has been reported to be overexpressed in mantle cell lymphoma (MCL) due to the chromosomal translocation. CCND1 has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Over-expression of CCND1 is known to correlate with the early onset of cancer and risk of tumor progression and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit, chicken, zebrafish, bovine, hamster, goat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0689 Product name: Recombinant human Cyclin D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-245 aa of BC000076 Sequence: LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR Predict reactive species\nFull Name: cyclin D1\nCalculated Molecular Weight: 295 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC000076\nGene Symbol: Cyclin D1\nGene ID (NCBI): 595\nRRID: AB_10793718\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P24385\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887967326377,"sku":"60186-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60186-1-ig","provider":"Iright","version":"1.0","type":"link"}