{"product_id":"proteintech-60216-1-ig","title":"Proteintech, 60216-1-Ig, CXCR7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCR7 (60216-1-Ig) by Proteintech is a Monoclonal antibody targeting CXCR7 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n60216-1-Ig targets CXCR7 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, U-87 MG cells,  Jurkat cells,  Raji cells,  K-562 cells,  THP-1 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue, human prostate cancer tissue,  mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a member of the G-protein coupled receptor family. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as a coreceptor with CXCR4 for a restricted number of HIV isolates. Expression of CXCR7 has been associated with cardiac development as well as with tumor growth and progression. This antibody recognizes endogenous CXCR7, which has an experimentally determined molecular weight of 50 kDa (PMID: 20197403; 20388803).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14247 Product name: Recombinant human CXCR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-362 aa of BC036661 Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Predict reactive species\nFull Name: chemokine (C-X-C motif) receptor 7\nCalculated Molecular Weight: 362 aa, 41 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC036661\nGene Symbol: CXCR7\nGene ID (NCBI): 57007\nRRID: AB_11182925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P25106\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888039317673,"sku":"60216-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60216-1-ig","provider":"Iright","version":"1.0","type":"link"}