{"product_id":"proteintech-60229-1-ig","title":"Proteintech, 60229-1-Ig, Myosin Light Chain 2\/MLC-2V Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Myosin Light Chain 2\/MLC-2V (60229-1-Ig) by Proteintech is a Monoclonal antibody targeting Myosin Light Chain 2\/MLC-2V in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n60229-1-Ig targets Myosin Light Chain 2\/MLC-2V in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, pig heart tissue,  rat heart tissue,  rabbit heart tissue\nPositive IHC detected in: mouse heart tissue, human heart tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYL2, also named as MLC-2v and MLC-2, is ventricular\/cardiac muscle isoform. Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10). Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2). MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1356 Product name: Recombinant human MYL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC015821 Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD Predict reactive species\nFull Name: myosin, light chain 2, regulatory, cardiac, slow\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC015821\nGene Symbol: Myosin Light Chain 2\nGene ID (NCBI): 4633\nRRID: AB_2881356\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P10916\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888021754025,"sku":"60229-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60229-1-ig","provider":"Iright","version":"1.0","type":"link"}