{"product_id":"proteintech-60237-1-ig","title":"Proteintech, 60237-1-Ig, COTL1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe COTL1 (60237-1-Ig) by Proteintech is a Monoclonal antibody targeting COTL1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n60237-1-Ig targets COTL1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, fetal human brain tissue,  human peripheral blood platelets,  HeLa cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOTL1, also named as CLP, binds to F-actin in a calcium-independent manner. And it has no direct effect on actin depolymerization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1230 Product name: Recombinant human COTL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC010884 Sequence: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE Predict reactive species\nFull Name: coactosin-like 1 (Dictyostelium)\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 14-16 kDa\nGenBank Accession Number: BC010884\nGene Symbol: COTL1\nGene ID (NCBI): 23406\nRRID: AB_2881360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14019\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888111145129,"sku":"60237-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60237-1-ig","provider":"Iright","version":"1.0","type":"link"}