{"product_id":"proteintech-60245-1-ig","title":"Proteintech, 60245-1-Ig, IL-17F Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-17F (60245-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-17F in WB, ELISA applications with reactivity to human samples\n60245-1-Ig targets IL-17F in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe interleukin 17 (IL-17) family of cytokines contains 6 structurally related cytokines,  IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 family plays crucial roles in host defense against microbial organisms and in the development of inflammatory diseases.  IL-17A is a pro-inflammatory cytokine that also has the capacity to promote angiogenesis and osteoclastogenesis. IL-17F shares the highest homology with IL-17A and signals via a receptor composed by the IL-17RA and IL-17RC subunits. IL-17A and IL-17F can form IL-17A\/A or IL-17F\/F homodimers, IL-17A\/F heterodimers are also formed. IL-17A and IL-17F, produced by the Th17 CD4(+) T cell lineage, have been linked to a variety of inflammatory and autoimmune conditions. IL-17F levels are elevated in sera and lesional psoriatic skin compared to non-lesional tissue. IL-17F also has been implicated in the development of neutrophilic airway inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16310 Product name: Recombinant human IL-17F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC070124 Sequence: MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ Predict reactive species\nFull Name: interleukin 17F\nCalculated Molecular Weight: 163 aa, 18 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC070124\nGene Symbol: IL-17F\nGene ID (NCBI): 112744\nRRID: AB_2881367\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96PD4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888065302697,"sku":"60245-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60245-1-ig","provider":"Iright","version":"1.0","type":"link"}