{"product_id":"proteintech-60252-1-ig","title":"Proteintech, 60252-1-Ig, MAPK13 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAPK13 (60252-1-Ig) by Proteintech is a Monoclonal antibody targeting MAPK13 in WB, IHC, ELISA applications with reactivity to human samples\n60252-1-Ig targets MAPK13 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Ramos cells, HepG2 cells,  Daudi cells,  HEK-293 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAPK13(Mitogen-activated protein kinase 13) is also named as PRKM13, SAPK4 and belongs to the protein kinase superfamily. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21240 Product name: Recombinant human MAPK13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 307-365 aa of BC000433 Sequence: FFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL Predict reactive species\nFull Name: mitogen-activated protein kinase 13\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 38-42 kDa\nGenBank Accession Number: BC000433\nGene Symbol: MAPK13\nGene ID (NCBI): 5603\nRRID: AB_2881373\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15264\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888291074217,"sku":"60252-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60252-1-ig","provider":"Iright","version":"1.0","type":"link"}