{"product_id":"proteintech-60270-1-ig","title":"Proteintech, 60270-1-Ig, IL-28A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-28A (60270-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-28A in IHC, IF-P, ELISA applications with reactivity to human samples\n60270-1-Ig targets IL-28A in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand\/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nAffinity: K D =1.77 x 10 9 M K Off =4.10 x 10 -5 M K On =2.31 x 10 4 M\nImmunogen: CatNo: Ag18525 Product name: Recombinant human IL-28A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-91 aa of BC113583 Sequence: TVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQV Predict reactive species\nFull Name: interleukin 28A (interferon, lambda 2)\nCalculated Molecular Weight: 200 aa, 22 kDa\nGenBank Accession Number: BC113583\nGene Symbol: IL-28A\nGene ID (NCBI): 282616\nRRID: AB_2881390\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8IZJ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888065466537,"sku":"60270-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60270-1-ig","provider":"Iright","version":"1.0","type":"link"}