{"product_id":"proteintech-60281-1-ig","title":"Proteintech, 60281-1-Ig, SECTM1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SECTM1 (60281-1-Ig) by Proteintech is a Monoclonal antibody targeting SECTM1 in WB, IHC, ELISA applications with reactivity to human samples\n60281-1-Ig targets SECTM1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells, JAR cells,  NCCIT cells,  PC-3 cells,  LNCaP cells,  HeLa cells,  K-562 cells\nPositive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSECTM1, also named as protein K12, is originally identified by its location just upstream of the CD7 locus. It has been proposed as a ligand for CD7. SECTM1 is involved in thymocyte signaling. This antibody is specific to SECTM1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14645 Product name: Recombinant human SECTM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-248 aa of BC017716 Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP Predict reactive species\nFull Name: secreted and transmembrane 1\nCalculated Molecular Weight: 248 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC017716\nGene Symbol: SECTM1\nGene ID (NCBI): 6398\nRRID: AB_2881399\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Thiophilic affinity chromatograph\nUNIPROT ID: Q8WVN6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888074936489,"sku":"60281-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60281-1-ig","provider":"Iright","version":"1.0","type":"link"}