{"product_id":"proteintech-60291-1-ig","title":"Proteintech, 60291-1-Ig, TNF-alpha Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNF-alpha (60291-1-Ig) by Proteintech is a Monoclonal antibody targeting TNF-alpha in WB, ELISA applications with reactivity to human, rat samples\n60291-1-Ig targets TNF-alpha in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A\/TNFR1 and TNFRSF1B\/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat, pig, rabbit, monkey, chicken, bovine, duck\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11413 Product name: Recombinant human TNF-a protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-233 aa of BC028148 Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Predict reactive species\nFull Name: tumor necrosis factor (TNF superfamily, member 2)\nCalculated Molecular Weight: 233 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC028148\nGene Symbol: TNF-alpha\nGene ID (NCBI): 7124\nENSEMBL Gene ID: ENSG00000232810\nRRID: AB_2833255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01375\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887967654057,"sku":"60291-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60291-1-ig","provider":"Iright","version":"1.0","type":"link"}