{"product_id":"proteintech-60297-1-ig","title":"Proteintech, 60297-1-Ig, CYP2D6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYP2D6 (60297-1-Ig) by Proteintech is a Monoclonal antibody targeting CYP2D6 in WB, IHC, ELISA applications with reactivity to human samples\n60297-1-Ig targets CYP2D6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  fetal human brain tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYP2D6(Cytochrome P450 2D6) is also named as CYP2DL1 and belongs to the cytochrome P450 family. It is a monooxygenase that involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants. CYP2D6 is responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It has 2 isoforms produced by alternative splicing with the molecular weight of 56 kDa and 50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12605 Product name: Recombinant human CYP2D6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 148-497 aa of BC075023 Sequence: SLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR Predict reactive species\nFull Name: cytochrome P450, family 2, subfamily D, polypeptide 6\nCalculated Molecular Weight: 497 aa, 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC075023\nGene Symbol: CYP2D6\nGene ID (NCBI): 1565\nRRID: AB_2881412\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10635\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888148533417,"sku":"60297-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60297-1-ig","provider":"Iright","version":"1.0","type":"link"}