{"product_id":"proteintech-60333-1-ig","title":"Proteintech, 60333-1-Ig, TMEM106B (1-46aa) Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM106B (1-46aa) (60333-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM106B (1-46aa) in WB, IP, ELISA applications with reactivity to human samples\n60333-1-Ig targets TMEM106B (1-46aa) in WB, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HeLa cells,  K-562 cells,  LNCaP cells,  A549 cells,  Jurkat cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21448 Product name: Recombinant human TMEM106B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC033901 Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS Predict reactive species\nFull Name: transmembrane protein 106B\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: ~40 kDa\nGenBank Accession Number: BC033901\nGene Symbol: TMEM106B\nGene ID (NCBI): 54664\nRRID: AB_2881442\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NUM4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888001863849,"sku":"60333-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60333-1-ig","provider":"Iright","version":"1.0","type":"link"}