{"product_id":"proteintech-60341-1-ig","title":"Proteintech, 60341-1-Ig, FGF18 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF18 (60341-1-Ig) by Proteintech is a Monoclonal antibody targeting FGF18 in WB, ELISA applications with reactivity to human,  mouse, rabbit samples\n60341-1-Ig targets FGF18 in WB, ELISA applications and shows reactivity with human,  mouse, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFGF18 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rabbit\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2041 Product name: Recombinant human FGF18 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-207 aa of BC006245 Sequence: MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA Predict reactive species\nFull Name: fibroblast growth factor 18\nCalculated Molecular Weight: 207 aa, 24 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC006245\nGene Symbol: FGF18\nGene ID (NCBI): 8817\nRRID: AB_2881450\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O76093\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888062353577,"sku":"60341-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60341-1-ig","provider":"Iright","version":"1.0","type":"link"}