{"product_id":"proteintech-60343-1-ig","title":"Proteintech, 60343-1-Ig, Prostein Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Prostein (60343-1-Ig) by Proteintech is a Monoclonal antibody targeting Prostein in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n60343-1-Ig targets Prostein in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue, JAR cells,  mouse testis tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human prostate cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProstein is a prostate tissue-specific protein whose expression is highly restricted to normal and cancerous prostate tissues. Anti-prostein is useful for the identification of prostate adenocarcinomas and is a good marker to identify prostatic origin in metastatic cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5463 Product name: Recombinant human SLC45A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 405-553 aa of BC050416 Sequence: REKQVFLPKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA Predict reactive species\nFull Name: solute carrier family 45, member 3\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 55-59 kDa\nGenBank Accession Number: BC050416\nGene Symbol: Prostein\nGene ID (NCBI): 85414\nRRID: AB_2881452\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96JT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888314011817,"sku":"60343-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60343-1-ig","provider":"Iright","version":"1.0","type":"link"}