{"product_id":"proteintech-60344-1-ig","title":"Proteintech, 60344-1-Ig, LIN28A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIN28A (60344-1-Ig) by Proteintech is a Monoclonal antibody targeting LIN28A in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n60344-1-Ig targets LIN28A in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCCIT cell\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human prostate cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIN28 is one of the four key human factors (OCT4, SOX2, NANOG and LIN28) used to reprogram human fibroblasts to an embryonic stem (ES) cell-like state known as the induced pluripotent stem (Ips) cell. LIN28 is a marker of undifferentiated human embryonic stem cells and a cytoplasmic mRNA-binding protein that binds to and enhances the translation of the IGF2 mRNA. LIN28 has also been shown to bind to the let-7 pre-miRNA and block production of the mature let-7 microRNA in mouse embryonic stem cells. The calculated molecular weight of LIN28 is 23 kDa, but the modified LIN28 is about 28 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2312 Product name: Recombinant human LIN28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC028566 Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN Predict reactive species\nFull Name: lin-28 homolog (C. elegans)\nCalculated Molecular Weight: 209 aa, 23 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC028566\nGene Symbol: LIN28\nGene ID (NCBI): 79727\nRRID: AB_2881453\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H9Z2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888044331177,"sku":"60344-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60344-1-ig","provider":"Iright","version":"1.0","type":"link"}