{"product_id":"proteintech-60346-1-ig","title":"Proteintech, 60346-1-Ig, Gastrin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Gastrin (60346-1-Ig) by Proteintech is a Monoclonal antibody targeting Gastrin in IHC, IF-P, ELISA applications with reactivity to human samples\n60346-1-Ig targets Gastrin in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human stomach cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:100-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is a promiscuous hormone. Thus, the gastrin gene is expressed in common cancers such as bronchogenic, colorectal, ovarian and pancreatic carcinomas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12795 Product name: Recombinant human GAST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-101 aa of BC069724 Sequence: SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN Predict reactive species\nFull Name: gastrin\nCalculated Molecular Weight: 101 aa, 11 kDa\nGenBank Accession Number: BC069724\nGene Symbol: Gastrin\nGene ID (NCBI): 2520\nRRID: AB_2881455\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01350\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888042299561,"sku":"60346-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60346-1-ig","provider":"Iright","version":"1.0","type":"link"}