{"product_id":"proteintech-60349-1-ig","title":"Proteintech, 60349-1-Ig, BSAP,PAX5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BSAP,PAX5 (60349-1-Ig) by Proteintech is a Monoclonal antibody targeting BSAP,PAX5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n60349-1-Ig targets BSAP,PAX5 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Ramos cells,  Daudi cells,  Raji cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAX5, also named B-cell specific activator protein (BSAP), is a member of the highly conserved paired box (PAX)-domain family of transcription factors. PAX5 is essential in normal B-cell lymphopoiesis. It is expressed in pro-B, pre-B and mature B lymphocytes but not in plasma cells.  PAX5 is a common target in leukemogenesis of B-ALL ( B-lineage acute lymphoblastic leukemia) along with CDKN2A. Owing to its frequent deletion in B-ALL, PAX5 could be used as one of the molecular markers in diagnosis and monitoring of the disease. This antibody is specific to PAX5. It will not cross react with other PAX members.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16023 Product name: Recombinant human BSAP,PAX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-391 aa of BC156927 Sequence: QPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH Predict reactive species\nFull Name: paired box 5\nCalculated Molecular Weight: 391 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC156927\nGene Symbol: PAX5\nGene ID (NCBI): 5079\nRRID: AB_2881458\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q02548\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888056881321,"sku":"60349-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60349-1-ig","provider":"Iright","version":"1.0","type":"link"}