{"product_id":"proteintech-60631-7-ig","title":"Proteintech, 60631-7-Ig, TMED9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMED9 (60631-7-Ig) by Proteintech is a Monoclonal antibody targeting TMED9 in WB, ELISA applications with reactivity to human, mouse, rat samples\n60631-7-Ig targets TMED9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  HeLa cells,  HepG2 cells,  K-562 cells,  pig liver tissue,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMED9 (also named as GMP25, GP25L2, or p25) is a member of the EMP24\/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13754 Product name: Recombinant human TMED9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-224 aa of BC001123 Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH Predict reactive species\nFull Name: transmembrane emp24 protein transport domain containing 9\nCalculated Molecular Weight: 235 aa, 27 kDa\nObserved Molecular Weight: 24-27 kDa\nGenBank Accession Number: BC001123\nGene Symbol: TMED9\nGene ID (NCBI): 54732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BVK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888331280553,"sku":"60631-7-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60631-7-ig","provider":"Iright","version":"1.0","type":"link"}