{"product_id":"proteintech-60763-7-ig","title":"Proteintech, 60763-7-Ig, CD268\/BAFF-R Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD268\/BAFF-R (60763-7-Ig) by Proteintech is a Monoclonal antibody targeting CD268\/BAFF-R in IHC, ELISA applications with reactivity to human samples\n60763-7-Ig targets CD268\/BAFF-R in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB-cell-activating factor receptor (BAFF-R, also known as CD268 and TNFRSF13C) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It is expressed in most malignant B cells, including those in primary central nervous system lymphoma (PCNSL), and is involved in the survival and proliferation of these cells (PMID: 32528875). The interaction of BAFF with BAFF-R promotes NF-κB activation, which plays a crucial role in B-cell maturation, survival, and costimulation of T-cell activation and proliferation (PMID: 30349534). Additionally, BAFF-R is associated with chronic kidney disease (CKD) by activating NF-κB signaling in renal tubular epithelial cells (PMID: 38791453).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18512 Product name: Recombinant human TNFRSF13C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC105123 Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 13C\nCalculated Molecular Weight: 184 aa, 19 kDa\nGenBank Accession Number: BC105123\nGene Symbol: TNFRSF13C\nGene ID (NCBI): 115650\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96RJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888105836713,"sku":"60763-7-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60763-7-ig","provider":"Iright","version":"1.0","type":"link"}