{"product_id":"proteintech-60905-1-ig","title":"Proteintech, 60905-1-Ig, USP22 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP22 (60905-1-Ig) by Proteintech is a Monoclonal antibody targeting USP22 in WB, ELISA applications with reactivity to human samples\n60905-1-Ig targets USP22 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP22, also named as KIAA1063 and USP3L, belongs to the peptidase C19 family and UBP8 subfamily. It is histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. USP22 catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. It is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. USP22 is required for nuclear receptor-mediated transactivation and cell cycle progression. USP22 has 2 isoforms with molecular mass of 58kDa and 60 kDa. The antibody is specific to USP22.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag34933 Product name: Recombinant human USP22 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 130-176 aa of NM_015276 Sequence: MEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLR Predict reactive species\nFull Name: ubiquitin specific peptidase 22\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: NM_015276\nGene Symbol: USP22\nGene ID (NCBI): 23326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UPT9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888335573161,"sku":"60905-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60905-1-ig","provider":"Iright","version":"1.0","type":"link"}