{"product_id":"proteintech-60931-1-ig","title":"Proteintech, 60931-1-Ig, GLP1R Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLP1R (60931-1-Ig) by Proteintech is a Monoclonal antibody targeting GLP1R in IF\/ICC, ELISA applications with reactivity to human, rat samples\n60931-1-Ig targets GLP1R in IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLP1R (glucagon-like peptide-1 receptor) is a G protein-coupled receptor belonging to the secretin receptor superfamily, also known as class B (PMID:34911028). GLP1R is widely distributed in pancreatic islets, muscles, the gastrointestinal tract, the lung, liver, pancreas, and other tissues or organs (PMID:35989517). Moreover, GLP1R agonist has been reported to induce autophagy of EC (Endometrial carcinoma) cells, and high GLP1R expression may be associated with good prognosis of EC patients, suggesting that GLP1R is likely to participate in the progression of EC (PMID:29907137). Moreover, regarding the molecular weight of GLP1R, research shows that the bands at ~50 kDa and ~100 kDa belong to the monomer and dimer states of GLP1R (PMID: 28609478).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23529 Product name: Recombinant human GLP1R protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 26-145 aa of BC112126 Sequence: QGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Predict reactive species\nFull Name: glucagon-like peptide 1 receptor\nCalculated Molecular Weight: 463 aa, 53 kDa\nGenBank Accession Number: BC112126\nGene Symbol: GLP1R\nGene ID (NCBI): 2740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P43220\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888280522921,"sku":"60931-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-60931-1-ig","provider":"Iright","version":"1.0","type":"link"}