{"product_id":"proteintech-66025-1-ig","title":"Proteintech, 66025-1-Ig, EIF3M Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF3M (66025-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF3M in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66025-1-Ig targets EIF3M in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  PC-12 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human colon cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF3M gene encodes eukaryotic translation initiation factor (eIF) subunit M, also called GA17 or PCID1. eIF-3 complex is required for several steps in the initiation of protein synthesis, and recent studies indicate that regulation of oncogene expression and neoplastic transformation are controlled by eIF subunits. The most uncharacterized non-core subunit EIF3M was confirmed to be highly expressed in human cancer cell lines and colon cancer patient tissues and mediate regulation of tumorigenesis-related genes in human colon cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17965 Product name: Recombinant human EIF3M protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-374 aa of BC019103 Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT Predict reactive species\nFull Name: eukaryotic translation initiation factor 3, subunit M\nCalculated Molecular Weight: 374 aa, 43 kDa\nObserved Molecular Weight: 35-43 kDa\nGenBank Accession Number: BC019103\nGene Symbol: EIF3M\nGene ID (NCBI): 10480\nRRID: AB_11042448\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q7L2H7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888274231465,"sku":"66025-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66025-1-ig","provider":"Iright","version":"1.0","type":"link"}