{"product_id":"proteintech-66039-3-ig","title":"Proteintech, 66039-3-Ig, CPT1A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPT1A (66039-3-Ig) by Proteintech is a Monoclonal antibody targeting CPT1A in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n66039-3-Ig targets CPT1A in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TT cells, HeLa cells,  rat liver tissue,  mouse liver tissue,  LNCaP cells,  PANC-1 cells,  HaCaT cells\nPositive IP detected in: MCF-7 cells, HepG2 cells\nPositive IHC detected in: mouse heart tissue, mouse skeletal muscle tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCPT1A, also named as CPT1, CPT1-L and L-CPTI, belongs to the carnitine\/choline acetyltransferase family. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active forms of related liver-type carnitine palmitoyltransferase I. (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7745 Product name: Recombinant human CPT1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 406-756 aa of BC000185 Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT Predict reactive species\nFull Name: carnitine palmitoyltransferase 1A (liver)\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 86 kDa\nGenBank Accession Number: BC000185\nGene Symbol: CPT1A\nGene ID (NCBI): 1374\nRRID: AB_3670374\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P50416\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888111374505,"sku":"66039-3-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66039-3-ig","provider":"Iright","version":"1.0","type":"link"}