{"product_id":"proteintech-66042-1-ig","title":"Proteintech, 66042-1-Ig, Fibronectin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Fibronectin (66042-1-Ig) by Proteintech is a Monoclonal antibody targeting Fibronectin in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n66042-1-Ig targets Fibronectin in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue, human plasma,  rat serum,  HuH-7 cells,  HepG2 cells,  MG-63 cells,  U2OS cells\nPositive IP detected in: human plasma tissue\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibronectin 1 (FN1) is a high molecular weight glycoprotein which exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1). Plasma FN1 (dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. FN1 binds to cell surfaces through integrins and to various compounds including collagen, fibrin and heparin. It is involved in cell adhesion and migration processes including embryogenesis, wound healing, hemostasis, host defense, and metastasis. (PMID: 7276612; 12244123; 12847088)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, canine, sheep\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8016 Product name: Recombinant human FN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2177-2386 aa of BC005858 Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE Predict reactive species\nFull Name: fibronectin 1\nCalculated Molecular Weight: 2386 aa, 263 kDa\nObserved Molecular Weight: 263 kDa\nGenBank Accession Number: BC005858\nGene Symbol: Fibronectin\nGene ID (NCBI): 2335\nRRID: AB_11182385\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P02751\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887970570409,"sku":"66042-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66042-1-ig","provider":"Iright","version":"1.0","type":"link"}