{"product_id":"proteintech-66050-1-ig","title":"Proteintech, 66050-1-Ig, NDUFA4L2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFA4L2 (66050-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFA4L2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66050-1-Ig targets NDUFA4L2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Hela cells\nPositive IHC detected in: human breast cancer tissue,  human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells, OS-RC-2 cells,  MCF-7 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFA4L2, also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9233 Product name: Recombinant human NDUFA4L2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2\nCalculated Molecular Weight: 87 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC011910\nGene Symbol: NDUFA4L2\nGene ID (NCBI): 56901\nRRID: AB_11045656\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NRX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888046330025,"sku":"66050-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66050-1-ig","provider":"Iright","version":"1.0","type":"link"}