{"product_id":"proteintech-66085-1-ig","title":"Proteintech, 66085-1-Ig, HDAC1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC1 (66085-1-Ig) by Proteintech is a Monoclonal antibody targeting HDAC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66085-1-Ig targets HDAC1 in WB, IHC, IF\/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IHC detected in: human lymphoma tissue, human lung cancer tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:6000-1:24000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone deacetylases(HDAC) are a class of enzymes that remove the acetyl groups from the lysine residues leading to the formation of a condensed and transcriptionally silenced chromatin. The protein encoded by this gene belongs to the histone deacetylase\/acuc\/apha family and is a component of the histone deacetylase complex, which is responsible for gene expression silencing. It also plays an important role in the control of cell proliferation and differentiation by interacting with RB, p53 and other transcription factors. At least 4 classes of HDAC were identified. As a class I HDAC, HDAC 1 was primarily found in the nucleus. This antibody is raised against residues near the C terminus of human HDAC1. The calculated molecular weight of HDAC1 is 55 kDa, but modified HDAC1 is about 60-65 kDa .\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19128 Product name: Recombinant human HDAC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 184-482 aa of BC000301 Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA Predict reactive species\nFull Name: histone deacetylase 1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC000301\nGene Symbol: HDAC1\nGene ID (NCBI): 3065\nRRID: AB_11232033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13547\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887986757801,"sku":"66085-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66085-1-ig","provider":"Iright","version":"1.0","type":"link"}