{"product_id":"proteintech-66106-1-ig","title":"Proteintech, 66106-1-Ig, SULT4A1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SULT4A1 (66106-1-Ig) by Proteintech is a Monoclonal antibody targeting SULT4A1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n66106-1-Ig targets SULT4A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Human brain,   tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSULT4A1, also named as SULTX3, NST, ST4A1, hBR-STL and hBR-STL-1, belongs to the sulfotransferase 1 family. It may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT4A1 displays activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphtylamine, and 2-naphtol. It may have a role in the sulfation of drugs and neurotransmitters in the CNS. SULT4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. It is a novel cytosolic sulfotransferase that is primarily expressed in the brain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17962 Product name: Recombinant human SULT4A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-284 aa of BC022459 Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL Predict reactive species\nFull Name: sulfotransferase family 4A, member 1\nCalculated Molecular Weight: 284 aa, 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC022459\nGene Symbol: SULT4A1\nGene ID (NCBI): 25830\nRRID: AB_2881505\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BR01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888328233129,"sku":"66106-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66106-1-ig","provider":"Iright","version":"1.0","type":"link"}