{"product_id":"proteintech-66118-1-ig","title":"Proteintech, 66118-1-Ig, FUT8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUT8 (66118-1-Ig) by Proteintech is a Monoclonal antibody targeting FUT8 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n66118-1-Ig targets FUT8 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, MDA-MB-453s cells,  MCF-7 cells,  Caco-2 cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissue,  human lung cancer tissue,  mouse cerebellum tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFucosyltransferase 8 (FUT8) is GDP-fucose-glycoprotein fucosyltransferase and is localized in Golgi apparatus. FUT8 is involved in protein glycosylation by catalyzing the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans. FUT8 may be involved in human aging by regulating protein N-glycosylation and in the molecular pathogenesis of human pulmonary emphysema (PE).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18769 Product name: Recombinant human FUT8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 276-575 aa of BC025385 Sequence: HWSGEVKDKNVQVVEFPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK Predict reactive species\nFull Name: fucosyltransferase 8 (alpha (1,6) fucosyltransferase)\nCalculated Molecular Weight: 66 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC025385\nGene Symbol: FUT8\nGene ID (NCBI): 2530\nRRID: AB_2881517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BYC5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887990263977,"sku":"66118-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66118-1-ig","provider":"Iright","version":"1.0","type":"link"}