{"product_id":"proteintech-66134-1-ig","title":"Proteintech, 66134-1-Ig, GOSR2\/Membrin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GOSR2\/Membrin (66134-1-Ig) by Proteintech is a Monoclonal antibody targeting GOSR2\/Membrin in WB, IHC, IF-P, ELISA applications with reactivity to human, rat samples\n66134-1-Ig targets GOSR2\/Membrin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HSC-T6 cells,  Jurkat cells,  PC-12 cells,  HEK-293 cells,  HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGolgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the solube NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in Golgi apparatus. It is involved in transport of proteins from the cis\/medial-Golgi to the trans-Golgi network.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21393 Product name: Recombinant human GOSR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-192 aa of BC009710 Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF Predict reactive species\nFull Name: golgi SNAP receptor complex member 2\nCalculated Molecular Weight: 212 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC009710\nGene Symbol: Membrin\nGene ID (NCBI): 9570\nRRID: AB_2881533\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O14653\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888063664297,"sku":"66134-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66134-1-ig","provider":"Iright","version":"1.0","type":"link"}