{"product_id":"proteintech-66140-1-ig","title":"Proteintech, 66140-1-Ig, C9orf72 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe C9orf72 (66140-1-Ig) by Proteintech is a Monoclonal antibody targeting C9orf72 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n66140-1-Ig targets C9orf72 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, C6 cells,  Neuro-2a cells\nPositive IP detected in: C6 cells\nPositive IHC detected in: human gliomas tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). FTLD-TDP has five subtypes: Sporadic FTLD, GRN mutation FTLD, TARDBP mutation FTLD, VCP mutation FTLD and C9ORF72 mutation FTLD. The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21080 Product name: Recombinant human C9orf72 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-169 aa of BC020851 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG Predict reactive species\nFull Name: chromosome 9 open reading frame 72\nCalculated Molecular Weight: 481 aa, 54 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC020851\nGene Symbol: C9orf72\nGene ID (NCBI): 203228\nRRID: AB_2784547\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96LT7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888009564329,"sku":"66140-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66140-1-ig","provider":"Iright","version":"1.0","type":"link"}