{"product_id":"proteintech-66157-1-ig","title":"Proteintech, 66157-1-Ig, C3\/C3b\/C3c Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe C3\/C3b\/C3c (66157-1-Ig) by Proteintech is a Monoclonal antibody targeting C3\/C3b\/C3c in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n66157-1-Ig targets C3\/C3b\/C3c in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, human blood,  human plasma,  HepG2 cells,  J774A.1 cells,  RAW 264.7 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). The third component of complement, C3, plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways (PMID: 11414361). Human C3, composed of α and β chains (115 and 75 kDa, respectively), is cleaved into C3a and C3b by C3 convertase. C3b is further cleaved into iC3b, C3c, C3dg and C3f. This antibody raised against 1314-1663 aa of human C3 protein recognizes the C3 alpha chain, C3b alpha' chain, and C3c alpha' chain fragment 2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15955 Product name: Recombinant human C3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1314-1663 aa of BC150179 Sequence: ESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN Predict reactive species\nFull Name: complement component 3\nCalculated Molecular Weight: 1663 aa, 187 kDa\nObserved Molecular Weight: 115 kDa\nGenBank Accession Number: BC150179\nGene Symbol: C3\nGene ID (NCBI): 718\nRRID: AB_2881553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P01024\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888009498793,"sku":"66157-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66157-1-ig","provider":"Iright","version":"1.0","type":"link"}