{"product_id":"proteintech-66159-1-ig","title":"Proteintech, 66159-1-Ig, NAPRT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NAPRT1 (66159-1-Ig) by Proteintech is a Monoclonal antibody targeting NAPRT1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n66159-1-Ig targets NAPRT1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HEK-293 cells,  Jurkat cells,  HepG2 cells,  LNCaP cells,  HeLa cells,  K-562 cells\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:100-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNicotinic acid (NA) is a coenzyme in cellular redox reactions, and is an essential component of metabolic pathways in all living cells. NAPRT1 (Nicotinate phosphoribosyltransferase) is essential for increasing cellular NAD levels and, thus, to prevent oxidative stress of cells. NAPRT1 converts Nicotinic acid (NA; niacin) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4265 Product name: Recombinant human NAPRT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-310 aa of BC032466 Sequence: MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP Predict reactive species\nFull Name: nicotinate phosphoribosyltransferase domain containing 1\nCalculated Molecular Weight: 514 aa, 55 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC032466\nGene Symbol: NAPRT1\nGene ID (NCBI): 93100\nRRID: AB_2881555\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6XQN6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888004059305,"sku":"66159-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66159-1-ig","provider":"Iright","version":"1.0","type":"link"}