{"product_id":"proteintech-66191-1-ig","title":"Proteintech, 66191-1-Ig, VAPB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAPB (66191-1-Ig) by Proteintech is a Monoclonal antibody targeting VAPB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66191-1-Ig targets VAPB in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  LNCaP cells,  MCF-7 cells,  HeLa cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human breast cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR) and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease including late onset spinal muscular atrophy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, monkey, yeast\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6313 Product name: Recombinant human VAPB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-180 aa of BC001712 Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV Predict reactive species\nFull Name: VAMP (vesicle-associated membrane protein)-associated protein B and C\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 30-32 kDa\nGenBank Accession Number: BC001712\nGene Symbol: VAPB\nGene ID (NCBI): 9217\nRRID: AB_2881586\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O95292\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887984005289,"sku":"66191-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66191-1-ig","provider":"Iright","version":"1.0","type":"link"}