{"product_id":"proteintech-66215-1-ig","title":"Proteintech, 66215-1-Ig, APOD Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOD (66215-1-Ig) by Proteintech is a Monoclonal antibody targeting APOD in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n66215-1-Ig targets APOD in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue, human plasma,  human urine sample,  human placenta tissue\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21422 Product name: Recombinant human APOD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 15-189 aa of BC007402 Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS Predict reactive species\nFull Name: apolipoprotein D\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 30-33 kDa\nGenBank Accession Number: BC007402\nGene Symbol: APOD\nGene ID (NCBI): 347\nRRID: AB_2881606\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P05090\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888036663465,"sku":"66215-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66215-1-ig","provider":"Iright","version":"1.0","type":"link"}