{"product_id":"proteintech-66224-1-ig","title":"Proteintech, 66224-1-Ig, CD43 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD43 (66224-1-Ig) by Proteintech is a Monoclonal antibody targeting CD43 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n66224-1-Ig targets CD43 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  K-562 cells\nPositive IHC detected in: human tonsillitis tissue, human appendicitis tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\nPositive IF\/ICC detected in: Jurkat cells, human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD43, also named leukosialin, sialophorin, galactoglycoprotein, leukocyte sialoglycoprotein, SPN, and is a mucin-like type I transmembrane protein. In humans, it is expressed in haematopoietic cells, including T lymphocytes, monocytes, granulocytes, natural killer cells, platelets, and haematopoietic stem cells, with the exception of mature erythrocytes and B cell subpopulations. The unglycosylated form of CD43 migrates on SDS-PAGE with a molecular weight of 54 kDa (PMID: 2943740), whereas CD43 from different haematopoietic cell lines displays increased molecular weights since it is glycosylated with O-linked chains that differ in core structure and sialylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23595 Product name: Recombinant human SPN protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 101-400 aa of BC012350 Sequence: KMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP Predict reactive species\nFull Name: sialophorin\nCalculated Molecular Weight: 400 aa, 43 kDa\nObserved Molecular Weight: 115 kDa\nGenBank Accession Number: BC012350\nGene Symbol: CD43\nGene ID (NCBI): 6693\nENSEMBL Gene ID: ENSG00000197471\nRRID: AB_2881615\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P16150\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888106328233,"sku":"66224-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66224-1-ig","provider":"Iright","version":"1.0","type":"link"}