{"product_id":"proteintech-66227-1-ig","title":"Proteintech, 66227-1-Ig, S100A10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A10 (66227-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A10 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66227-1-Ig targets S100A10 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human lung tissue\nPositive IHC detected in: human colon cancer tissue, human cervical cancer tissue,  human liver cancer tissue,  human pancreas cancer tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, Saos-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A10, also known as p11, is a member of the S100 family of small, EF hand containing dimeric proteins. S100 proteins are localized in the cytoplasm and\/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A10 is present on the surface of endothelial and other cells in a heterotetrameric complex with another Ca(2+)-binding protein, annexin II. S100A10 may function in exocytosis and endocytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23596 Product name: Recombinant human S100A10 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-97 aa of BC015973 Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Predict reactive species\nFull Name: S100 calcium binding protein A10\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC015973\nGene Symbol: S100A10\nGene ID (NCBI): 6281\nRRID: AB_2881618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P60903\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888033222825,"sku":"66227-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66227-1-ig","provider":"Iright","version":"1.0","type":"link"}