{"product_id":"proteintech-66237-1-ig","title":"Proteintech, 66237-1-Ig, Mammaglobin A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mammaglobin A (66237-1-Ig) by Proteintech is a Monoclonal antibody targeting Mammaglobin A in IHC, IF-P, ELISA applications with reactivity to human samples\n66237-1-Ig targets Mammaglobin A in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammaglobin A, also known as SCGB2A2, is a member of the secretoglobin superfamily. Mammaglobin A is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. This monoclonal antibody is raised against full-length of 93-amino acid human mammaglobin A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag22485 Product name: Recombinant human SCGB2A2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-93 aa of BC128252 Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Predict reactive species\nFull Name: secretoglobin, family 2A, member 2\nCalculated Molecular Weight: 93 aa, 10 kDa\nGenBank Accession Number: BC128252\nGene Symbol: Mammaglobin A\nGene ID (NCBI): 4250\nRRID: AB_2881626\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13296\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888290812073,"sku":"66237-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66237-1-ig","provider":"Iright","version":"1.0","type":"link"}