{"product_id":"proteintech-66319-1-ig","title":"Proteintech, 66319-1-Ig, IL-21R Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-21R (66319-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-21R in WB, IHC, ELISA applications with reactivity to human samples\n66319-1-Ig targets IL-21R in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A172 cells,  MJ cells,  K-562 cells,  TF-1 cells,  MOLT-4 cells,  HuT 78 cells,  NK-92 cells,  human placenta tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL21R, a receptor for interleukin-21, belongs to the type I cytokine receptor family. IL21R has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21295 Product name: Recombinant human IL-21R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 239-538 aa of BC004348 Sequence: LLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS Predict reactive species\nFull Name: interleukin 21 receptor\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC004348\nGene Symbol: IL-21R\nGene ID (NCBI): 50615\nRRID: AB_2881700\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9HBE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888286486697,"sku":"66319-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66319-1-ig","provider":"Iright","version":"1.0","type":"link"}