{"product_id":"proteintech-66324-1-ig","title":"Proteintech, 66324-1-Ig, TRIM24 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM24 (66324-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM24 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66324-1-Ig targets TRIM24 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MCF-7 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  HepG2 cells\nPositive IHC detected in: human lung cancer tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM24, also named as RNF82, TIF1 and TIF1A, interacts selectively in vitro with the AF2-activating domain of the estrogen receptors. Association with DNA-bound estrogen receptors, it requires the presence of estradiol. It is a regulation protein of P53. Defects in TRIM24 are a cause of thyroid papillary carcinoma (TPC) which is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5417 Product name: Recombinant human TRIM24 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 701-1050 aa of BC028689 Sequence: SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK Predict reactive species\nFull Name: tripartite motif-containing 24\nCalculated Molecular Weight: 117 kDa\nObserved Molecular Weight: 116 kDa\nGenBank Accession Number: BC028689\nGene Symbol: TRIM24\nGene ID (NCBI): 8805\nRRID: AB_2881705\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15164\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888332755113,"sku":"66324-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66324-1-ig","provider":"Iright","version":"1.0","type":"link"}