{"product_id":"proteintech-66341-1-ig","title":"Proteintech, 66341-1-Ig, PHF10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHF10 (66341-1-Ig) by Proteintech is a Monoclonal antibody targeting PHF10 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n66341-1-Ig targets PHF10 in WB, IF, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue,  HEK-293 cells,  Neuro-2a cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHF10, also named as BRG1-associated factor 45a, is a 498 amino acid protein, which locate in the nucleus and Belongs to the SAYP family. PHF10 Involve in transcription activity regulation by chromatin remodeling. It Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem\/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem\/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A\/BAF53A and PHF10\/BAF45A, are exchanged for homologous alternative ACTL6B\/BAF53B and DPF1\/BAF45B or DPF3\/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal\/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. PHF10 exists as several isoform and the calculated molecular weight of each isoform is 42 kDa, 37 kDa, 51 kDa, and 56 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19096 Product name: Recombinant human PHF10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-408 aa of BC020954 Sequence: MLQEQVSEYLGVTSFKRKYPERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG Predict reactive species\nFull Name: PHD finger protein 10\nCalculated Molecular Weight: 408 aa, 46 kDa\nObserved Molecular Weight: 56 kDa, 35 kDa\nGenBank Accession Number: BC020954\nGene Symbol: PHF10\nGene ID (NCBI): 55274\nRRID: AB_2881721\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8WUB8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888031682729,"sku":"66341-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66341-1-ig","provider":"Iright","version":"1.0","type":"link"}