{"product_id":"proteintech-66354-1-ig","title":"Proteintech, 66354-1-Ig, EBI3\/IL-27B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EBI3\/IL-27B (66354-1-Ig) by Proteintech is a Monoclonal antibody targeting EBI3\/IL-27B in WB, ELISA applications with reactivity to human, rat, pig samples\n66354-1-Ig targets EBI3\/IL-27B in WB, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human spleen tissue,  rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEBI3, a 34-kDa secreted glycoprotein, is a subunit in 2 distinct heterodimeric cytokines: IL-27 and IL-35. IL-27, composed of p28 (IL-27) and EBI3, can trigger signaling in T cells, B cells, and myeloid cells. IL-35, composed of EBI3 and the ubiquitously expressed p35 subunit of IL-12, is an inhibitory cytokine involved in regulatory T-cell function. EBI3 plays a role in regulating cell-mediated immune responses. (PMID: 8551575; 18033300; 17874423; 21931777)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3051 Product name: Recombinant human EBI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC015364 Sequence: MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK Predict reactive species\nFull Name: Epstein-Barr virus induced 3\nCalculated Molecular Weight: 229 aa, 25 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC015364\nGene Symbol: EBI3\nGene ID (NCBI): 10148\nRRID: AB_2881734\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14213\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888273379497,"sku":"66354-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66354-1-ig","provider":"Iright","version":"1.0","type":"link"}