{"product_id":"proteintech-66386-1-ig","title":"Proteintech, 66386-1-Ig, PADI2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PADI2 (66386-1-Ig) by Proteintech is a Monoclonal antibody targeting PADI2 in WB, IHC, IF-P, ELISA applications with reactivity to human,  mouse,  rat, rabbit, pig samples\n66386-1-Ig targets PADI2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human,  mouse,  rat, rabbit, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue, HeLa cells,  MCF-7 cells,  pig brain tissue,  rat brain tissue,  mouse brain tissue,  rat skeletal muscle tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPADI2, also named as KIAA0994, PDI2, PAD-H19 and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, rabbit, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17612 Product name: Recombinant human PADI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 118-438 aa of BC009701 Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL Predict reactive species\nFull Name: peptidyl arginine deiminase, type II\nCalculated Molecular Weight: 665 aa, 75 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC009701\nGene Symbol: PADI2\nGene ID (NCBI): 11240\nRRID: AB_2881762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y2J8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888001241257,"sku":"66386-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66386-1-ig","provider":"Iright","version":"1.0","type":"link"}