{"product_id":"proteintech-66389-1-ig","title":"Proteintech, 66389-1-Ig, FKBPL Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FKBPL (66389-1-Ig) by Proteintech is a Monoclonal antibody targeting FKBPL in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n66389-1-Ig targets FKBPL in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-10A cells, HeLa cells,  HEK-293 cells,  Jurkat cells,  Raji cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells,  Calu-3 cells,  Caco-2 cells,  HepG2 cells,  C6 cells\nPositive IHC detected in: human breast cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBPL levels may be a prognostic indicator and determinant of response to endocrine therapy(PMID:20103631, 15664193) .It can be detected the band between 38 kDa and 48 kDa by western blot.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0112 Product name: Recombinant human FKBPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-237 aa of BC004168 Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL Predict reactive species\nFull Name: FK506 binding protein like\nCalculated Molecular Weight: 349 aa, 38 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC004168\nGene Symbol: FKBPL\nGene ID (NCBI): 63943\nRRID: AB_2881765\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UIM3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888041939113,"sku":"66389-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66389-1-ig","provider":"Iright","version":"1.0","type":"link"}