{"product_id":"proteintech-66396-1-ig","title":"Proteintech, 66396-1-Ig, NF-M Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NF-M (66396-1-Ig) by Proteintech is a Monoclonal antibody targeting NF-M in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n66396-1-Ig targets NF-M in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, rat brain, mouse brain tissue,  PC-12 cells\nPositive IHC detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:200-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEFM, also named as NEF3 and NFM, belongs to the intermediate filament family. Neurofilaments are the 10 nm intermediate filaments found specifically in neurons. They are a major component of the cell's cytoskeleton, and provide support for normal axonal radial growth. Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. The names given to the three major neurofilament subunits are based upon the apparent molecular weight of the mammalian subunits on SDS-PAGE: NF-L, 65-68 kDa; NF-M,140-160 kDa and NF-H, 200-220 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag22709 Product name: Recombinant human NEFM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC002421 Sequence: MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSSAESSLDFSQSSSLLNGGSGPGGDYKLS Predict reactive species\nFull Name: neurofilament, medium polypeptide\nCalculated Molecular Weight: 102 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC002421\nGene Symbol: NF-M\nGene ID (NCBI): 4741\nRRID: AB_2881770\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P07197\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888305492137,"sku":"66396-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66396-1-ig","provider":"Iright","version":"1.0","type":"link"}