{"product_id":"proteintech-66397-1-ig","title":"Proteintech, 66397-1-Ig, PLA2G1B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLA2G1B (66397-1-Ig) by Proteintech is a Monoclonal antibody targeting PLA2G1B in WB, IHC, ELISA applications with reactivity to human, pig samples\n66397-1-Ig targets PLA2G1B in WB, IHC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig pancreas tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8812 Product name: Recombinant human PLA2G1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-70 aa of BC005386 Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV Predict reactive species\nFull Name: phospholipase A2, group IB (pancreas)\nCalculated Molecular Weight: 70aa,8 kDa; 148aa,16 kDa\nObserved Molecular Weight: 13-16 kDa\nGenBank Accession Number: BC005386\nGene Symbol: PLA2G1B\nGene ID (NCBI): 5319\nRRID: AB_2881771\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04054\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888071200937,"sku":"66397-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66397-1-ig","provider":"Iright","version":"1.0","type":"link"}