{"product_id":"proteintech-66447-1-ig","title":"Proteintech, 66447-1-Ig, HLA-G Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HLA-G (66447-1-Ig) by Proteintech is a Monoclonal antibody targeting HLA-G in WB, IHC, ELISA applications with reactivity to human samples\n66447-1-Ig targets HLA-G in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). HLA-G is a non-classical MHC class I molecule with multiple immunoregulatory properties. HLA-G exhibits a restricted pattern of expression that includes placental extravillous trophoblasts at the maternal-fetal interface, where it abolishes maternal immune cell activity against fetus and establishes immune tolerance. Aberrant expression of HLA-G has been found in a variety of human neoplastic diseases. It plays an important role in the escape of tumor cells from immunosurveillance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10839 Product name: Recombinant human HLA-G protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-308 aa of BC021708 Sequence: SHSMRYFSAAVSRPSRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEREGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETKPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI Predict reactive species\nFull Name: major histocompatibility complex, class I, G\nCalculated Molecular Weight: 338 aa, 38 kDa\nObserved Molecular Weight: 33-45 kDa\nGenBank Accession Number: BC021708\nGene Symbol: HLA-G\nGene ID (NCBI): 3135\nRRID: AB_2881816\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P17693\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887982858409,"sku":"66447-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66447-1-ig","provider":"Iright","version":"1.0","type":"link"}