{"product_id":"proteintech-66450-1-ig","title":"Proteintech, 66450-1-Ig, 4-1BBL\/TNFSF9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe 4-1BBL\/TNFSF9 (66450-1-Ig) by Proteintech is a Monoclonal antibody targeting 4-1BBL\/TNFSF9 in WB, ELISA applications with reactivity to human samples\n66450-1-Ig targets 4-1BBL\/TNFSF9 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, SW 1990 cells,  LoVo cells,  Caki-1 cells,  Caki-2 cells,  SCaBER cells,  Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNFSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells\/macrophages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12768 Product name: Recombinant human TNFSF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-254 aa of BC104805 Sequence: WAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 9\nCalculated Molecular Weight: 254 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC104805\nGene Symbol: TNFSF9\nGene ID (NCBI): 8744\nRRID: AB_2881819\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P41273\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888002158761,"sku":"66450-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66450-1-ig","provider":"Iright","version":"1.0","type":"link"}