{"product_id":"proteintech-66458-1-ig","title":"Proteintech, 66458-1-Ig, GABARAPL1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GABARAPL1 (66458-1-Ig) by Proteintech is a Monoclonal antibody targeting GABARAPL1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66458-1-Ig targets GABARAPL1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  pig brain tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2 and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle and at very low levels in the thymus and small intestine.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species\nFull Name: GABA(A) receptor-associated protein like 1\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC009309\nGene Symbol: GABARAPL1\nGene ID (NCBI): 23710\nRRID: AB_2881827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H0R8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888028537001,"sku":"66458-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66458-1-ig","provider":"Iright","version":"1.0","type":"link"}