{"product_id":"proteintech-66468-1-ig","title":"Proteintech, 66468-1-Ig, CRABP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRABP2 (66468-1-Ig) by Proteintech is a Monoclonal antibody targeting CRABP2 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n66468-1-Ig targets CRABP2 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells, HEK-293 cells,  MCF-7 cells,  pig skin tissue,  rat skin tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human skin cancer tissue\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2500-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered.  Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown.  CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0309 Product name: Recombinant human CRABP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC001109 Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE Predict reactive species\nFull Name: cellular retinoic acid binding protein 2\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC001109\nGene Symbol: CRABP2\nGene ID (NCBI): 1382\nRRID: AB_2881836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P29373\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888026472617,"sku":"66468-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66468-1-ig","provider":"Iright","version":"1.0","type":"link"}