{"product_id":"proteintech-66487-1-ig","title":"Proteintech, 66487-1-Ig, CLTC Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLTC (66487-1-Ig) by Proteintech is a Monoclonal antibody targeting CLTC in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n66487-1-Ig targets CLTC in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  Raji cells,  rat brain tissue,  Jurkat cells,  ROS1728 cells,  pig brain tissue,  HEK-293 cells,  K-562 cells,  rabbit brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat, pig, monkey, chicken\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25040 Product name: Recombinant human CLTC protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-351 aa of BC054489 Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM Predict reactive species\nFull Name: clathrin, heavy chain (Hc)\nCalculated Molecular Weight: 192 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: BC054489\nGene Symbol: CLTC\nGene ID (NCBI): 1213\nRRID: AB_2881852\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q00610\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887991050409,"sku":"66487-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66487-1-ig","provider":"Iright","version":"1.0","type":"link"}